Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCSK1 polyclonal antibody (A01)

  • Catalog # : H00005122-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PCSK1.
  • Immunogen:
  • PCSK1 (NP_000430, 652 a.a. ~ 753 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005122-A01
    Western Blot detection against Immunogen (37.33 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5122
  • Gene Name:
  • PCSK1
  • Gene Alias:
  • BMIQ12,NEC1,PC1,PC3,SPC3
  • Gene Description:
  • proprotein convertase subtilisin/kexin type 1
  • Gene Summary:
  • The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a type I proinsulin-processing enzyme that plays a key role in regulating insulin biosynthesis. It is also known to cleave proopiomelanocortin, prorenin, proenkephalin, prodynorphin, prosomatostatin and progastrin. Mutations in this gene are thought to cause obesity. This encoded protein is associated with carcinoid tumors. The use of alternate polyadenylation sites has been found for this gene. Multiple alternatively spliced transcript variants have been described for this gene but their full length nature is not known. [provided by RefSeq
  • Other Designations:
  • neuroendocrine convertase 1,prohormone convertase 1,prohormone convertase 3,proprotein convertase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook