Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCOLN3 (Human) Recombinant Protein (P02)

  • Catalog # : H00005119-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PCOLN3 full-length ORF ( NP_002759.2, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005119-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5119
  • Gene Name:
  • CHMP1A
  • Gene Alias:
  • CHMP1,KIAA0047,PCOLN3,PRSM1
  • Gene Description:
  • chromatin modifying protein 1A
  • Gene Summary:
  • This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. [provided by RefSeq
  • Other Designations:
  • charged multivesicular body protein 1/chromatin modifying protein 1,procollagen (type III) N-endopeptidase,protease, metallo, 1, 33kD
  • RSS
  • YouTube
  • Linkedin
  • Facebook