Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHMP1A purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005119-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CHMP1A protein.
  • Immunogen:
  • CHMP1A (NP_002759.2, 1 a.a. ~ 196 a.a) full-length human protein.
  • Sequence:
  • MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CHMP1A expression in transfected 293T cell line (H00005119-T02) by CHMP1A MaxPab polyclonal antibody.

    Lane 1: PCOLN3 transfected lysate(21.56 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5119
  • Gene Name:
  • CHMP1A
  • Gene Alias:
  • CHMP1,KIAA0047,PCOLN3,PRSM1
  • Gene Description:
  • chromatin modifying protein 1A
  • Gene Summary:
  • This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. [provided by RefSeq
  • Other Designations:
  • charged multivesicular body protein 1/chromatin modifying protein 1,procollagen (type III) N-endopeptidase,protease, metallo, 1, 33kD
  • RSS
  • YouTube
  • Linkedin
  • Facebook