PCDH8 monoclonal antibody (M01), clone 6A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PCDH8 monoclonal antibody (M01), clone 6A8 Western Blot analysis of PCDH8 expression in COLO 320 HSR ( Cat # L020V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PCDH8 expression in transfected 293T cell line by PCDH8 monoclonal antibody (M01), clone 6A8.
Lane 1: PCDH8 transfected lysate(113 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PCDH8 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCDH8 is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PCDH8 over-expressed 293 cell line, cotransfected with PCDH8 Validated Chimera RNAi ( Cat # H00005100-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDH8 monoclonal antibody (M01), clone 6A8 (Cat # H00005100-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCDH8.
Immunogen
PCDH8 (NP_002581, 32 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCDH8 monoclonal antibody (M01), clone 6A8 Western Blot analysis of PCDH8 expression in COLO 320 HSR ( Cat # L020V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PCDH8 expression in transfected 293T cell line by PCDH8 monoclonal antibody (M01), clone 6A8.
Lane 1: PCDH8 transfected lysate(113 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PCDH8 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCDH8 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PCDH8 over-expressed 293 cell line, cotransfected with PCDH8 Validated Chimera RNAi ( Cat # H00005100-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDH8 monoclonal antibody (M01), clone 6A8 (Cat # H00005100-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PCDH8
Entrez GeneID
5100GeneBank Accession#
NM_002590Protein Accession#
NP_002581Gene Name
PCDH8
Gene Alias
ARCADLIN, PAPC
Gene Description
protocadherin 8
Omim ID
603580Gene Ontology
HyperlinkGene Summary
This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails. [provided by RefSeq
Other Designations
OTTHUMP00000018464|OTTHUMP00000018465
-
Interactome
-
Publication Reference
-
Comparative distribution of Arcadlin/Protocadherin-8 mRNA in the intact and ischemic brains of adult mice.
Yosuke Inoue, Toshinori Sawano, Natsumi Yamaguchi, Shota Inoue, Akinori Takayama, Shuma Nakazawa, Shinobu Inagaki, Jin Nakatani, Hidekazu Tanaka.
The Journal of Comparative Neurology 2022 Aug; 530(11):2033.
Application：WB, Mouse, Hippocampus.
-
Dendritic Spine Density is Increased in Arcadlin-deleted Mouse Hippocampus.
Chiaki Takeuchi, Miho Ishikawa, Toshinori Sawano, Yuki Shin, Nanano Mizuta, Saki Hasegawa, Rina Tanaka, Yuma Tsuboi, Jin Nakatani, Hiroko Sugiura, Kanato Yamagata, Hidekazu Tanaka.
Neuroscience 2020 Aug; 442:296.
Application：WB-Ti, Mouse, Mouse Hippocampus.
-
Serotonin induces Arcadlin in hippocampal neurons.
Tanaka H, Sawano T, Konishi N, Harada R, Takeuchi C, Shin Y, Sugiura H, Nakatani J, Fujimoto T, Yamagata K.
Neuroscience Letters 2020 Mar; 721:134783.
Application：WB-Ce, WB-Ti, Mouse, Rat, Hippocampal neurons, Hippocampus.
-
Identification of cell surface targets through meta-analysis of microarray data.
Haeberle H, Dudley JT, Liu JT, Butte AJ, Contag CH.
Neoplasia 2012 Jul; 14(7):666.
Application：IHC-P, Human, Human medulloblastoma, cerebellum.
-
Comparative distribution of Arcadlin/Protocadherin-8 mRNA in the intact and ischemic brains of adult mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com