Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCDH1 polyclonal antibody (A01)

  • Catalog # : H00005097-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PCDH1.
  • Immunogen:
  • PCDH1 (NP_002578, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005097-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5097
  • Gene Name:
  • PCDH1
  • Gene Alias:
  • FLJ53887,MGC45991,PC42,PCDH42
  • Gene Description:
  • protocadherin 1
  • Gene Summary:
  • This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160067,cadherin-like 1,cadherin-like protein 1,protocadherin 42
  • RSS
  • YouTube
  • Linkedin
  • Facebook