PCBP1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PCBP1.
Immunogen
PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Sequence
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCBP1 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of PCBP1 expression in Y-79 ( Cat # L042V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PCBP1
Entrez GeneID
5093GeneBank Accession#
BC039742Protein Accession#
AAH39742Gene Name
PCBP1
Gene Alias
HNRPE1, HNRPX, hnRNP-E1, hnRNP-X
Gene Description
poly(rC) binding protein 1
Omim ID
601209Gene Ontology
HyperlinkGene Summary
This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. [provided by RefSeq
Other Designations
alpha-CP1|heterogeneous nuclear ribonucleoprotein E1|heterogenous nuclear ribonucleoprotein E1|heterogenous nuclear ribonucleoprotein X|nucleic acid binding protein sub 2.3
-
Interactome
-
Publication Reference
-
Post-Transcriptional Regulation of the Human Mu-Opioid Receptor (MOR) by Morphine-Induced RNA Binding Proteins hnRNP K and PCBP1.
Song KY, Choi HS, Law PY, Wei LN, Loh HH.
Journal of Cellular Physiology 2017 Mar; 232(3):576.
Application:WB-Ce, WB-Tr, Human, NMB, NMB1 cells.
-
Establishing an in vivo p48ZnF bioluminescence mouse brain imaging model.
Heese K.
Neuroscience Letters 2013 May; 542:97.
Application:IP-WB, Rat, PC12 cells.
-
PCBP1 is required for maintenance of the transcriptionally silent state in fully grown mouse oocytes.
Xia M, He H, Wang Y, Liu M, Zhou T, Lin M, Zhou Z, Huo R, Zhou Q, Sha J.
Cell Cycle 2012 Aug; 11(15):2833.
Application:IF, Mouse, mouse embryos.
-
Global analysis reveals multiple pathways for unique regulation of mRNA decay in induced pluripotent stem cells.
Neff AT, Lee JY, Wilusz J, Tian B, Wilusz CJ.
Genome Research 2012 Aug; 22(8):1457.
Application:WB-Ce, Human, HFF, iPS cells.
-
Post-Transcriptional Regulation of the Human Mu-Opioid Receptor (MOR) by Morphine-Induced RNA Binding Proteins hnRNP K and PCBP1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com