PBX3 monoclonal antibody (M01), clone 1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PBX3 monoclonal antibody (M01), clone 1A9 Western Blot analysis of PBX3 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PBX3 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.97 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PBX3.
Immunogen
PBX3 (NP_006186, 342 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PBX3 monoclonal antibody (M01), clone 1A9 Western Blot analysis of PBX3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PBX3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PBX3
-
Interactome
-
Disease
-
Publication Reference
-
PBX3 is a putative biomarker of aggressive prostate cancer.
Ramberg H, Grytli HH, Nygård S, Wang W, Ögren O, Zhao S, Løvf M, Katz B, Skotheim RI, Bjartell A, Eri LM, Berge V, Svindland A, Taskén KA.
International Journal of Cancer 2016 Oct; 139(8):1810.
Application：IHC-P, Human, Benign and malignant prostate tissue.
-
PBX3 is a putative biomarker of aggressive prostate cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com