Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PBX2 polyclonal antibody (A01)

  • Catalog # : H00005089-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PBX2.
  • Immunogen:
  • PBX2 (NP_002577, 354 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005089-A01
    Western Blot detection against Immunogen (34.58 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5089
  • Gene Name:
  • PBX2
  • Gene Alias:
  • G17,HOX12,PBX2MHC
  • Gene Description:
  • pre-B-cell leukemia homeobox 2
  • Gene Summary:
  • This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029151,homeobox 12,pre-B-cell leukemia transcription factor 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook