PAX9 monoclonal antibody (M03), clone 4B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PAX9.
Immunogen
PAX9 (NP_006185, 205 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.56 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PAX9 monoclonal antibody (M03), clone 4B9. Western Blot analysis of PAX9 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
PAX9 monoclonal antibody (M03), clone 4B9 Western Blot analysis of PAX9 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of PAX9 expression in transfected 293T cell line by PAX9 monoclonal antibody (M03), clone 4B9.
Lane 1: PAX9 transfected lysate(36.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PAX9 over-expressed 293 cell line, cotransfected with PAX9 Validated Chimera RNAi ( Cat # H00005083-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PAX9 monoclonal antibody (M03), clone 4B9 (Cat # H00005083-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PAX9
Entrez GeneID
5083GeneBank Accession#
NM_006194Protein Accession#
NP_006185Gene Name
PAX9
Gene Alias
-
Gene Description
paired box 9
Gene Ontology
HyperlinkGene Summary
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 9 gene is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements. [provided by RefSeq
Other Designations
paired box gene 9|paired domain gene 9
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com