PAX9 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PAX9 MaxPab polyclonal antibody. Western Blot analysis of PAX9 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of PAX9 expression in transfected 293T cell line (H00005083-T01) by PAX9 MaxPab polyclonal antibody.
Lane 1: PAX9 transfected lysate(37.51 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PAX9 protein.
Immunogen
PAX9 (NP_006185.1, 1 a.a. ~ 341 a.a) full-length human protein.
Sequence
MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PAX9 MaxPab polyclonal antibody. Western Blot analysis of PAX9 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of PAX9 expression in transfected 293T cell line (H00005083-T01) by PAX9 MaxPab polyclonal antibody.
Lane 1: PAX9 transfected lysate(37.51 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PAX9
Entrez GeneID
5083GeneBank Accession#
NM_006194.1Protein Accession#
NP_006185.1Gene Name
PAX9
Gene Alias
-
Gene Description
paired box 9
Gene Ontology
HyperlinkGene Summary
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 9 gene is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements. [provided by RefSeq
Other Designations
paired box gene 9|paired domain gene 9
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com