PAX7 monoclonal antibody (M03), clone 3C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant PAX7.
Immunogen
PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PAX7 monoclonal antibody (M03), clone 3C9. Western Blot analysis of PAX7 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
PAX7 monoclonal antibody (M03), clone 3C9 Western Blot analysis of PAX7 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
PAX7 monoclonal antibody (M03), clone 3C9. Western Blot analysis of PAX7 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAX7 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — PAX7
Entrez GeneID
5081GeneBank Accession#
NM_002584Protein Accession#
NP_002575.1Gene Name
PAX7
Gene Alias
HUP1, PAX7B
Gene Description
paired box 7
Gene Ontology
HyperlinkGene Summary
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000002534|PAX7 transcriptional factor|paired box gene 7|paired box homeotic gene 7|paired domain gene 7
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com