PAX6 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PAX6 partial ORF ( AAH11953, 291 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
FSTSVYQPIPQPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PAX6
Entrez GeneID
5080GeneBank Accession#
BC011953Protein Accession#
AAH11953Gene Name
PAX6
Gene Alias
AN, AN2, D11S812E, MGC17209, MGDA, WAGR
Gene Description
paired box 6
Gene Ontology
HyperlinkGene Summary
This gene encodes paired box gene 6, one of many human homologs of the Drosophila melanogaster gene prd. In addition to the hallmark feature of this gene family, a conserved paired box domain, the encoded protein also contains a homeo box domain. Both domains are known to bind DNA, and function as regulators of gene transcription. This gene is expressed in the developing nervous system, and in developing eyes. Mutations in this gene are known to cause ocular disorders such as aniridia and Peter's anomaly. Alternatively spliced transcript variants encoding either the same or different isoform have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000038833|OTTHUMP00000038834|OTTHUMP00000038835|OTTHUMP00000038836|OTTHUMP00000038837|OTTHUMP00000038838|OTTHUMP00000038839|OTTHUMP00000038840|paired box gene 6|paired box homeotic gene-6
-
Interactome
-
Pathway
-
Disease
- Abnormalities
- Alcoholism
- Atherosclerosis
- Atrophy
- Autistic Disorder
- Blepharoptosis
- Calcinosis
- Cleft Lip
- Cleft Palate
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com