Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAX6 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005080-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PAX6 partial ORF ( AAH11953, 291 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FSTSVYQPIPQPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005080-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5080
  • Gene Name:
  • PAX6
  • Gene Alias:
  • AN,AN2,D11S812E,MGC17209,MGDA,WAGR
  • Gene Description:
  • paired box 6
  • Gene Summary:
  • This gene encodes paired box gene 6, one of many human homologs of the Drosophila melanogaster gene prd. In addition to the hallmark feature of this gene family, a conserved paired box domain, the encoded protein also contains a homeo box domain. Both domains are known to bind DNA, and function as regulators of gene transcription. This gene is expressed in the developing nervous system, and in developing eyes. Mutations in this gene are known to cause ocular disorders such as aniridia and Peter's anomaly. Alternatively spliced transcript variants encoding either the same or different isoform have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000038833,OTTHUMP00000038834,OTTHUMP00000038835,OTTHUMP00000038836,OTTHUMP00000038837,OTTHUMP00000038838,OTTHUMP00000038839,OTTHUMP00000038840,paired box gene 6,paired box homeotic gene-6
  • RSS
  • YouTube
  • Linkedin
  • Facebook