PAX5 monoclonal antibody (M01), clone 8F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PAX5 monoclonal antibody (M01), clone 8F9. Western Blot analysis of PAX5 expression in IMR-32.
Western Blot (Transfected lysate)
Western Blot analysis of PAX5 expression in transfected 293T cell line by PAX5 monoclonal antibody (M01), clone 8F9.
Lane 1: PAX5 transfected lysate(42.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PAX5 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAX5 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PAX5 over-expressed 293 cell line, cotransfected with PAX5 Validated Chimera RNAi ( Cat # H00005079-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PAX5 monoclonal antibody (M01), clone 8F9 (Cat # H00005079-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PAX5.
Immunogen
PAX5 (NP_057953, 192 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPI
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PAX5 monoclonal antibody (M01), clone 8F9. Western Blot analysis of PAX5 expression in IMR-32.Western Blot (Transfected lysate)
Western Blot analysis of PAX5 expression in transfected 293T cell line by PAX5 monoclonal antibody (M01), clone 8F9.
Lane 1: PAX5 transfected lysate(42.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PAX5 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAX5 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PAX5 over-expressed 293 cell line, cotransfected with PAX5 Validated Chimera RNAi ( Cat # H00005079-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PAX5 monoclonal antibody (M01), clone 8F9 (Cat # H00005079-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PAX5
Entrez GeneID
5079GeneBank Accession#
NM_016734Protein Accession#
NP_057953Gene Name
PAX5
Gene Alias
BSAP
Gene Description
paired box 5
Omim ID
167414Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternatively spliced transcript variants encoding different isoforms have been described but their biological validity has not been determined. [provided by RefSeq
Other Designations
B-cell lineage specific activator|paired box homeotic gene 5|transcription factor PAX 5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com