PAX2 monoclonal antibody (M02), clone 2E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PAX2 monoclonal antibody (M02), clone 2E4 Western Blot analysis of PAX2 expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PAX2.
Immunogen
PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PAX2 monoclonal antibody (M02), clone 2E4 Western Blot analysis of PAX2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — PAX2
Entrez GeneID
5076GeneBank Accession#
NM_000278Protein Accession#
NP_000269Gene Name
PAX2
Gene Alias
-
Gene Description
paired box 2
Gene Ontology
HyperlinkGene Summary
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000020286|OTTHUMP00000020287|paired box gene 2|paired box homeotic gene 2|paired box protein 2
-
Interactome
-
Disease
-
Publication Reference
-
PAX2 may induce ADAM10 expression in renal tubular epithelial cells and contribute to epithelial-to-mesenchymal transition.
Hou L, Du Y, Zhao C, Wu Y.
International Urology and Nephrology 2018 Sep; 50(9):1729.
Application：ChIP, Rat, NRK52E cells.
-
c-Jun is essential for the induction of Il-1?] gene expression in in vitro activated Bergmann glial cells.
Albanito L, Reddy CE, Musti AM.
Glia 2011 Dec; 59(12):1879.
Application：IHC-Fr, Mouse, Mouse cerebellum.
-
The transcription factor PAX2 regulates ADAM10 expression in renal cell carcinoma.
Doberstein K, Pfeilschifter J, Gutwein P.
Carcinogenesis 2011 Nov; 32(11):1713.
Application：ChIP, Human, A498 cells.
-
PAX2 may induce ADAM10 expression in renal tubular epithelial cells and contribute to epithelial-to-mesenchymal transition.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com