Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAPPA (Human) Recombinant Protein (Q01)

  • Catalog # : H00005069-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PAPPA partial ORF ( NP_002572, 85 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005069-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5069
  • Gene Name:
  • PAPPA
  • Gene Alias:
  • ASBABP2,DIPLA1,IGFBP-4ase,PAPA,PAPP-A,PAPPA1
  • Gene Description:
  • pregnancy-associated plasma protein A, pappalysin 1
  • Gene Summary:
  • This gene encodes a secreted metalloproteinase which cleaves insulin-like growth factor binding proteins (IGFBPs). It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022806,aspecific BCL2 ARE-binding protein 2,differentially placenta 1 expressed protein,insulin-like growth factor-dependent IGF binding protein-4 protease,pregnacy-associated plasma protein A,pregnancy-associated plasma protein A
  • RSS
  • YouTube
  • Linkedin
  • Facebook