Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAPPA polyclonal antibody (A01)

  • Catalog # : H00005069-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PAPPA.
  • Immunogen:
  • PAPPA (NP_002572, 85 a.a. ~ 194 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005069-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5069
  • Gene Name:
  • PAPPA
  • Gene Alias:
  • ASBABP2,DIPLA1,IGFBP-4ase,PAPA,PAPP-A,PAPPA1
  • Gene Description:
  • pregnancy-associated plasma protein A, pappalysin 1
  • Gene Summary:
  • This gene encodes a secreted metalloproteinase which cleaves insulin-like growth factor binding proteins (IGFBPs). It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022806,aspecific BCL2 ARE-binding protein 2,differentially placenta 1 expressed protein,insulin-like growth factor-dependent IGF binding protein-4 protease,pregnacy-associated plasma protein A,pregnancy-associated plasma protein A
  • RSS
  • YouTube
  • Linkedin
  • Facebook