Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAK3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005063-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PAK3 partial ORF ( NP_002569, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005063-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5063
  • Gene Name:
  • PAK3
  • Gene Alias:
  • CDKN1A,MRX30,MRX47,OPHN3,PAK3beta,bPAK,hPAK3
  • Gene Description:
  • p21 protein (Cdc42/Rac)-activated kinase 3
  • Gene Summary:
  • PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, serve as targets for the small GTP binding proteins Cdc42 and RAC and have been implicated in a wide range of biological activities. The protein encoded by this gene forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1 proteins which then catalyzes a variety of targets. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of non-syndromic mental retardation X-linked type 30 (MRX30), also called X-linked mental retardation type 47 (MRX47). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023855,OTTHUMP00000062894,beta-PAK,oligophrenin-3,p21 (CDKN1A)-activated kinase 3,p21-activated kinase 3,p21-activated kinase-3,serine/threonine-protein kinase PAK 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook