Product Browser

Last updated: 2017/10/22
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAFAH1B2 monoclonal antibody (M01A), clone 2F4-1C10

  • Catalog # : H00005049-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B2.
  • Immunogen:
  • PAFAH1B2 (AAH00398, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005049-M01A
    Western Blot detection against Immunogen (50.93 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PAFAH1B2 monoclonal antibody (M01A), clone 2F4-1C10. Western Blot analysis of PAFAH1B2 expression in human kidney.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5049
  • Gene Name:
  • PAFAH1B2
  • Gene Alias:
  • -
  • Gene Description:
  • platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa
  • Gene Summary:
  • Platelet-activating factor (PAF) is a biologically active phospholipid with diverse biologic effects. PAF is degraded to inactive products by hydrolysis of the acetyl group at the sn-2 position to produce the biologically inactive products LYSO-PAF and acetate. This reaction is catalyzed by PAF acetylhydrolase (PAFAH). The various monomeric and multimeric forms of the enzyme are composed of alpha (MIM 601545), beta, and gamma (MIM 603074) PAFAH subunits.[supplied by OMIM
  • Other Designations:
  • intracellular platelet-activating factor acetylhydrolase alpha 2 subunit,platelet-activating factor acetylhydrolase IB subunit beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook