PAEP monoclonal antibody (M02), clone 4E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PAEP.
Immunogen
PAEP (NP_002562, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Host
Mouse
Reactivity
Human
Isotype
IgG1 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAEP is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — PAEP
Entrez GeneID
5047GeneBank Accession#
NM_002571Protein Accession#
NP_002562Gene Name
PAEP
Gene Alias
GD, GdA, GdF, GdS, MGC138509, MGC142288, PAEG, PEP, PP14
Gene Description
progestagen-associated endometrial protein
Omim ID
173310Gene Ontology
HyperlinkGene Summary
This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. A number of alternatively spliced transcript variants have been observed at this locus, but the full-length nature of only two, each encoding the same protein, has been determined. [provided by RefSeq
Other Designations
OTTHUMP00000022548|OTTHUMP00000022549|OTTHUMP00000022550|PP14 protein (placental protein 14)|alpha uterine protein|glycodelin|glycodelin-A|glycodelin-F|glycodelin-S|pregnancy-associated endometrial alpha-2-globulin|progesterone-associated endometrial prot
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com