PAEP MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PAEP protein.
Immunogen
PAEP (NP_002562.2, 1 a.a. ~ 180 a.a) full-length human protein.
Sequence
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PAEP expression in transfected 293T cell line (H00005047-T01) by PAEP MaxPab polyclonal antibody.
Lane 1: PAEP transfected lysate(19.8 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to PAEP on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml] -
Gene Info — PAEP
Entrez GeneID
5047GeneBank Accession#
NM_002571.2Protein Accession#
NP_002562.2Gene Name
PAEP
Gene Alias
GD, GdA, GdF, GdS, MGC138509, MGC142288, PAEG, PEP, PP14
Gene Description
progestagen-associated endometrial protein
Omim ID
173310Gene Ontology
HyperlinkGene Summary
This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. A number of alternatively spliced transcript variants have been observed at this locus, but the full-length nature of only two, each encoding the same protein, has been determined. [provided by RefSeq
Other Designations
OTTHUMP00000022548|OTTHUMP00000022549|OTTHUMP00000022550|PP14 protein (placental protein 14)|alpha uterine protein|glycodelin|glycodelin-A|glycodelin-F|glycodelin-S|pregnancy-associated endometrial alpha-2-globulin|progesterone-associated endometrial prot
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com