PCSK6 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PCSK6 partial ORF ( NP_002561, 860 a.a. - 969 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PCSK6
Entrez GeneID
5046GeneBank Accession#
NM_002570Protein Accession#
NP_002561Gene Name
PCSK6
Gene Alias
PACE4, SPC4
Gene Description
proprotein convertase subtilisin/kexin type 6
Omim ID
167405Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
paired basic amino acid cleaving system 4|subtilisin-like proprotein convertase 4|subtilisin-like protease|subtilisin/kexin-like protease PACE4
-
Interactome
-
Disease
-
Publication Reference
-
Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) is a likely antigenic target in membranous nephropathy and nonsteroidal anti-inflammatory drug use.
Sanjeev Sethi, Marta Casal Moura, Benjamin Madden, Hanna Debiec, Samih H Nasr, Christopher P Larsen, LouAnn Gross, Vivian Negron, Raman Deep Singh, Karl A Nath, Aaron J Storey, Ulrich Specks, Fernando C Fervenza, Pierre Ronco, Tiffany N Caza.
2023 Apr; S0085-2538(23):312.
Application:WB, Recombinant proteins.
-
Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) is a likely antigenic target in membranous nephropathy and nonsteroidal anti-inflammatory drug use.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com