PA2G4 monoclonal antibody (M01), clone 2A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PA2G4 expression in transfected 293T cell line by PA2G4 monoclonal antibody (M01), clone 2A5.
Lane 1: PA2G4 transfected lysate(43.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PA2G4 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PA2G4 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PA2G4.
Immunogen
PA2G4 (AAH01951, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PA2G4 expression in transfected 293T cell line by PA2G4 monoclonal antibody (M01), clone 2A5.
Lane 1: PA2G4 transfected lysate(43.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PA2G4 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PA2G4 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PA2G4
Entrez GeneID
5036GeneBank Accession#
BC001951Protein Accession#
AAH01951Gene Name
PA2G4
Gene Alias
EBP1, HG4-1, p38-2G4
Gene Description
proliferation-associated 2G4, 38kDa
Omim ID
602145Gene Ontology
HyperlinkGene Summary
This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. [provided by RefSeq
Other Designations
ErbB-3 binding protein 1|ErbB3-binding protein 1|ErbB3-binding protein Ebp1|cell cycle protein p38-2G4 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com