Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

P2RY6 (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00005031-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human P2RY6 full-length ORF (NP_004145.1) recombinant protein without tag.
  • Sequence:
  • MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.4
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 5031
  • Gene Name:
  • P2RY6
  • Gene Alias:
  • MGC15335,P2Y6
  • Gene Description:
  • pyrimidinergic receptor P2Y, G-protein coupled, 6
  • Gene Summary:
  • The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is responsive to UDP, partially responsive to UTP and ADP, and not responsive to ATP. Four transcript variants encoding the same isoform have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • G-coupled nucleotide receptor,P2 purinoceptor,P2Y purinoceptor 6,P2Y6 receptor,pyrimidinergic receptor P2Y6
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook