P2RY1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
P2RY1 MaxPab polyclonal antibody. Western Blot analysis of P2RY1 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of P2RY1 expression in transfected 293T cell line (H00005028-T02) by P2RY1 MaxPab polyclonal antibody.
Lane 1: P2RY1 transfected lysate(42.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human P2RY1 protein.
Immunogen
P2RY1 (NP_002554.1, 1 a.a. ~ 373 a.a) full-length human protein.
Sequence
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
P2RY1 MaxPab polyclonal antibody. Western Blot analysis of P2RY1 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of P2RY1 expression in transfected 293T cell line (H00005028-T02) by P2RY1 MaxPab polyclonal antibody.
Lane 1: P2RY1 transfected lysate(42.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — P2RY1
Entrez GeneID
5028GeneBank Accession#
NM_002563Protein Accession#
NP_002554.1Gene Name
P2RY1
Gene Alias
P2Y1
Gene Description
purinergic receptor P2Y, G-protein coupled, 1
Omim ID
601167Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. [provided by RefSeq
Other Designations
ATP receptor|P2 purinoceptor subtype Y1|P2Y purinoceptor 1|platelet ADP receptor|purinergic receptor P2Y1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com