P2RX5 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human P2RX5 partial ORF ( NP_002552, 126 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — P2RX5
Entrez GeneID
5026GeneBank Accession#
NM_002561Protein Accession#
NP_002552Gene Name
P2RX5
Gene Alias
MGC47755, P2X5, P2X5R
Gene Description
purinergic receptor P2X, ligand-gated ion channel, 5
Omim ID
602836Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
ATP receptor subunit|P2X purinoceptor 5|ionotropic ATP receptor P2X5|purinergic receptor P2X ligand gated ion channel 5|purinergic receptor P2X5
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com