P2RX5 monoclonal antibody (M01), clone 1C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant P2RX5.
Immunogen
P2RX5 (NP_002552, 126 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of P2RX5 expression in transfected 293T cell line by P2RX5 monoclonal antibody (M01), clone 1C5.
Lane 1: P2RX5 transfected lysate(46.42 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged P2RX5 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of P2RX5 over-expressed 293 cell line, cotransfected with P2RX5 Validated Chimera RNAi ( Cat # H00005026-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with P2RX5 monoclonal antibody (M01), clone 1C5 (Cat # H00005026-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — P2RX5
Entrez GeneID
5026GeneBank Accession#
NM_002561Protein Accession#
NP_002552Gene Name
P2RX5
Gene Alias
MGC47755, P2X5, P2X5R
Gene Description
purinergic receptor P2X, ligand-gated ion channel, 5
Omim ID
602836Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
ATP receptor subunit|P2X purinoceptor 5|ionotropic ATP receptor P2X5|purinergic receptor P2X ligand gated ion channel 5|purinergic receptor P2X5
-
Interactome
-
Pathway
-
Publication Reference
-
A Truncation Variant of the Cation Channel P2RX5 Is Upregulated during T Cell Activation.
Abramowski P, Ogrodowczyk C, Martin R, Pongs O.
PLoS One 2014 Sep; 9(9):e104692.
Application:WB, Human, T cells.
-
A Truncation Variant of the Cation Channel P2RX5 Is Upregulated during T Cell Activation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com