P2RX5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human P2RX5 protein.
Immunogen
P2RX5 (NP_002552.2, 1 a.a. ~ 422 a.a) full-length human protein.
Sequence
MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
P2RX5 MaxPab polyclonal antibody. Western Blot analysis of P2RX5 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of P2RX5 expression in transfected 293T cell line (H00005026-T02) by P2RX5 MaxPab polyclonal antibody.
Lane 1: P2RX5 transfected lysate(46.42 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — P2RX5
Entrez GeneID
5026GeneBank Accession#
NM_002561.2Protein Accession#
NP_002552.2Gene Name
P2RX5
Gene Alias
MGC47755, P2X5, P2X5R
Gene Description
purinergic receptor P2X, ligand-gated ion channel, 5
Omim ID
602836Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
ATP receptor subunit|P2X purinoceptor 5|ionotropic ATP receptor P2X5|purinergic receptor P2X ligand gated ion channel 5|purinergic receptor P2X5
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com