P2RX4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human P2RX4 protein.
Immunogen
P2RX4 (NP_002551.2, 1 a.a. ~ 388 a.a) full-length human protein.
Sequence
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and P2RX4 expressing 293 cells (Green) using P2RX4 purified MaxPab mouse polyclonal antibody.Western Blot (Transfected lysate)
Western Blot analysis of P2RX4 expression in transfected 293T cell line (H00005025-T01) by P2RX4 MaxPab polyclonal antibody.
Lane 1: P2RX4 transfected lysate(42.68 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — P2RX4
Entrez GeneID
5025GeneBank Accession#
NM_002560.2Protein Accession#
NP_002551.2Gene Name
P2RX4
Gene Alias
P2X4, P2X4R
Gene Description
purinergic receptor P2X, ligand-gated ion channel, 4
Omim ID
600846Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants have been identified for this gene although their full-length natures have not been determined. [provided by RefSeq
Other Designations
ATP receptor|ATP-gated cation channel protein|P2X purinoceptor 4|P2X receptor, subunit 4|purinergic receptor P2X4|purinoceptor P2X4
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Purinergic receptors expressed in human skeletal muscle fibres.
Borno A, Ploug T, Bune LT, Rosenmeier JB, Thaning P.
Purinergic Signalling 2012 Jun; 8(2):255.
Application:IF, IHC-Fr, Human, Muscle from patients with type 2 diabetes.
-
Purinergic receptors expressed in human skeletal muscle fibres.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com