P2RX3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human P2RX3 partial ORF ( NP_002550, 45 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
HEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — P2RX3
Entrez GeneID
5024GeneBank Accession#
NM_002559Protein Accession#
NP_002550Gene Name
P2RX3
Gene Alias
MGC129956, P2X3
Gene Description
purinergic receptor P2X, ligand-gated ion channel, 3
Omim ID
600843Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and may transduce ATP-evoked nociceptor activation. Mouse studies suggest that this receptor is important for peripheral pain responses, and also participates in pathways controlling urinary bladder volume reflexes. It is possible that the development of selective antagonists for this receptor may have a therapeutic potential in pain relief and in the treatment of disorders of urine storage. [provided by RefSeq
Other Designations
ATP receptor|P2X purinoceptor 3|P2X receptor, subunit 3|purinergic receptor P2X3|purinoceptor P2X3
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com