P2RX1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of P2RX1 expression in transfected 293T cell line (H00005023-T05) by P2RX1 MaxPab polyclonal antibody.
Lane 1: P2RX1 transfected lysate(45.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human P2RX1 protein.
Immunogen
P2RX1 (NP_002549.1, 1 a.a. ~ 399 a.a) full-length human protein.
Sequence
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of P2RX1 expression in transfected 293T cell line (H00005023-T05) by P2RX1 MaxPab polyclonal antibody.
Lane 1: P2RX1 transfected lysate(45.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — P2RX1
Entrez GeneID
5023GeneBank Accession#
NM_002558Protein Accession#
NP_002549.1Gene Name
P2RX1
Gene Alias
P2X1
Gene Description
purinergic receptor P2X, ligand-gated ion channel, 1
Omim ID
600845Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill. [provided by RefSeq
Other Designations
ATP receptor|P2X purinoceptor 1|P2X receptor, subunit 1|P2X1 receptor|purinergic receptor P2X1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com