OTX1 monoclonal antibody (M01), clone 1F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of OTX1 expression in transfected 293T cell line by OTX1 monoclonal antibody (M01), clone 1F2.
Lane 1: OTX1 transfected lysate(37.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OTX1 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of OTX1 over-expressed 293 cell line, cotransfected with OTX1 Validated Chimera RNAi ( Cat # H00005013-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with OTX1 monoclonal antibody (M01), clone 1F2 (Cat # H00005013-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to OTX1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.51 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OTX1.
Immunogen
OTX1 (NP_055377, 10 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of OTX1 expression in transfected 293T cell line by OTX1 monoclonal antibody (M01), clone 1F2.
Lane 1: OTX1 transfected lysate(37.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OTX1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of OTX1 over-expressed 293 cell line, cotransfected with OTX1 Validated Chimera RNAi ( Cat # H00005013-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with OTX1 monoclonal antibody (M01), clone 1F2 (Cat # H00005013-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to OTX1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — OTX1
Entrez GeneID
5013GeneBank Accession#
NM_014562Protein Accession#
NP_055377Gene Name
OTX1
Gene Alias
FLJ38361, MGC15736
Gene Description
orthodenticle homeobox 1
Omim ID
600036Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. [provided by RefSeq
Other Designations
homeobox protein OTX1|orthodenticle homolog 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com