OTX1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
OTX1 polyclonal antibody (A01), Lot # MAI0060316QCS1 Western Blot analysis of OTX1 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Cell lysate)
OTX1 polyclonal antibody (A01), Lot # MAI0060316QCS1. Western Blot analysis of OTX1 expression in Raw 264.7.
Western Blot detection against Immunogen (37.88 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant OTX1.
Immunogen
OTX1 (NP_055377, 10 a.a. ~ 116 a.a) partial recombinant protein with GST tag.
Sequence
YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.88 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OTX1 polyclonal antibody (A01), Lot # MAI0060316QCS1 Western Blot analysis of OTX1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
OTX1 polyclonal antibody (A01), Lot # MAI0060316QCS1. Western Blot analysis of OTX1 expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — OTX1
Entrez GeneID
5013GeneBank Accession#
NM_014562Protein Accession#
NP_055377Gene Name
OTX1
Gene Alias
FLJ38361, MGC15736
Gene Description
orthodenticle homeobox 1
Omim ID
600036Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. [provided by RefSeq
Other Designations
homeobox protein OTX1|orthodenticle homolog 1
-
Interactome
-
Disease
-
Publication Reference
-
Murine Embryonic Stem Cell-Derived Pyramidal Neurons Integrate into the Cerebral Cortex and Appropriately Project Axons to Subcortical Targets.
Ideguchi M, Palmer TD, Recht LD, Weimann JM.
Journal of Neuroscience 2010 Jan; 30(3):894.
Application：IF, Mouse, cortical pyramidal neurons.
-
Expression of the homeobox genes PAX6, OTX2, and OTX1 in the early human fetal Retina.
Larsen KB, Lutterodt M, Rath MF, Moller M.
International Journal of Developmental Neuroscience 2009 Aug; 27(5):485.
Application：IHC-Fr, Human, Human fetal retinae.
-
Murine Embryonic Stem Cell-Derived Pyramidal Neurons Integrate into the Cerebral Cortex and Appropriately Project Axons to Subcortical Targets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com