ORM1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ORM1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in mouse testis.
Western Blot (Cell lysate)
ORM1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in Raw 264.7.
Western Blot (Transfected lysate)
Western Blot analysis of ORM1 expression in transfected 293T cell line (H00005004-T01) by ORM1 MaxPab polyclonal antibody.
Lane 1: ORM1 transfected lysate(23.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ORM1 protein.
Immunogen
ORM1 (NP_000598.1, 1 a.a. ~ 201 a.a) full-length human protein.
Sequence
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Rat (49)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ORM1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in mouse testis.Western Blot (Cell lysate)
ORM1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of ORM1 expression in transfected 293T cell line (H00005004-T01) by ORM1 MaxPab polyclonal antibody.
Lane 1: ORM1 transfected lysate(23.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ORM1
Entrez GeneID
5004GeneBank Accession#
NM_000607.1Protein Accession#
NP_000598.1Gene Name
ORM1
Gene Alias
AGP-A, AGP1, ORM
Gene Description
orosomucoid 1
Omim ID
138600Gene Ontology
HyperlinkGene Summary
This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. [provided by RefSeq
Other Designations
OTTHUMP00000022741|Orosomucoid-1 (alpha-1-acid glycoprotein-1)|alpha-1-acid glycoprotein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com