Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC22A18AS monoclonal antibody (M05), clone 4B1

  • Catalog # : H00005003-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant SLC22A18AS.
  • Immunogen:
  • SLC22A18AS (AAH30237.1, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005003-M05
    Western Blot detection against Immunogen (41.8 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SLC22A18AS expression in transfected 293T cell line by SLC22A18AS monoclonal antibody (M05), clone 4B1.

    Lane 1: SLC22A18AS transfected lysate (Predicted MW: 15.4 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SLC22A18AS is 0.3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5003
  • Gene Name:
  • SLC22A18AS
  • Gene Alias:
  • BWR1B,BWSCR1B,ORCTL2S,SLC22A1LS,p27-BWR1B
  • Gene Description:
  • solute carrier family 22 (organic cation transporter), member 18 antisense
  • Other Designations:
  • Beckwith-Wiedemann region 1B,Beckwith-Wiedemann syndrome chromosome region 1, candidate b,organic cation transporter-like 2 antisense,solute carrier family 22 (organic cation transporter), member 1-like antisense
  • RSS
  • YouTube
  • Linkedin
  • Facebook