Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC22A18AS polyclonal antibody (A01)

  • Catalog # : H00005003-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC22A18AS.
  • Immunogen:
  • SLC22A18AS (NP_009036, 144 a.a. ~ 253 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005003-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SLC22A18AS polyclonal antibody (A01), Lot # 061025JCS1 Western Blot analysis of SLC22A18AS expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5003
  • Gene Name:
  • SLC22A18AS
  • Gene Alias:
  • BWR1B,BWSCR1B,ORCTL2S,SLC22A1LS,p27-BWR1B
  • Gene Description:
  • solute carrier family 22 (organic cation transporter), member 18 antisense
  • Other Designations:
  • Beckwith-Wiedemann region 1B,Beckwith-Wiedemann syndrome chromosome region 1, candidate b,organic cation transporter-like 2 antisense,solute carrier family 22 (organic cation transporter), member 1-like antisense
  • RSS
  • YouTube
  • Linkedin
  • Facebook