Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ORC1L (Human) Recombinant Protein (Q01)

  • Catalog # : H00004998-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ORC1L partial ORF ( AAH11539, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004998-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4998
  • Gene Name:
  • ORC1L
  • Gene Alias:
  • HSORC1,ORC1,PARC1
  • Gene Description:
  • origin recognition complex, subunit 1-like (yeast)
  • Gene Summary:
  • The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is the largest subunit of the ORC complex. While other ORC subunits are stable throughout the cell cycle, the levels of this protein vary during the cell cycle, which has been shown to be controlled by ubiquitin-mediated proteolysis after initiation of DNA replication. This protein is found to be selectively phosphorylated during mitosis. It is also reported to interact with MYST histone acetyltransferase 2 (MyST2/HBO1), a protein involved in control of transcription silencing. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000009797,OTTHUMP00000009798,origin recognition complex 1,origin recognition complex, subunit 1,origin recognition complex, subunit 1, S. cerevisiae, homolog-like,replication control protein 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook