ORC1L monoclonal antibody (M01), clone 3H1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ORC1L on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ORC1L is 0.3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ORC1L.
Immunogen
ORC1L (AAH11539, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (64); Rat (68)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ORC1L on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ORC1L is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ORC1L
Entrez GeneID
4998GeneBank Accession#
BC011539Protein Accession#
AAH11539Gene Name
ORC1L
Gene Alias
HSORC1, ORC1, PARC1
Gene Description
origin recognition complex, subunit 1-like (yeast)
Omim ID
601902Gene Ontology
HyperlinkGene Summary
The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is the largest subunit of the ORC complex. While other ORC subunits are stable throughout the cell cycle, the levels of this protein vary during the cell cycle, which has been shown to be controlled by ubiquitin-mediated proteolysis after initiation of DNA replication. This protein is found to be selectively phosphorylated during mitosis. It is also reported to interact with MYST histone acetyltransferase 2 (MyST2/HBO1), a protein involved in control of transcription silencing. [provided by RefSeq
Other Designations
OTTHUMP00000009797|OTTHUMP00000009798|origin recognition complex 1|origin recognition complex, subunit 1|origin recognition complex, subunit 1, S. cerevisiae, homolog-like|replication control protein 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com