Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OPHN1 polyclonal antibody (A01)

  • Catalog # : H00004983-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant OPHN1.
  • Immunogen:
  • OPHN1 (NP_002538, 641 a.a. ~ 734 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QRSGETDPGRKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTKTPSFHIKRPAPRPLAHHKEGDADSFSKVRPPGEK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004983-A01
    Western Blot detection against Immunogen (36.45 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4983
  • Gene Name:
  • OPHN1
  • Gene Alias:
  • MRX60,OPN1
  • Gene Description:
  • oligophrenin 1
  • Gene Summary:
  • This gene encodes a Rho-GTPase-activating protein that promotes GTP hydrolysis of Rho subfamily members. Rho proteins are important mediators of intracellular signal transduction, which affects cell migration and cell morphogenesis. Mutations in this gene are responsible for OPHN1-related X-linked mental retardation with cerebellar hypoplasia and distinctive facial dysmorhphism. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023451,mental retardation, X-linked 60,oligophrenin-1, Rho-GTPase activating protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook