Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OLR1 (Human) Recombinant Protein (P01)

  • Catalog # : H00004973-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human OLR1 full-length ORF ( AAH22295, 1 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 55.77
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004973-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4973
  • Gene Name:
  • OLR1
  • Gene Alias:
  • CLEC8A,LOX1,SCARE1
  • Gene Description:
  • oxidized low density lipoprotein (lectin-like) receptor 1
  • Gene Summary:
  • This gene encodes a receptor protein which belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternative transcript variants have been described but their full-length sequence has not been determined. [provided by RefSeq
  • Other Designations:
  • lectin-type oxidized LDL receptor 1,oxidised low density lipoprotein (lectin-like) receptor 1,scavenger receptor class E, member 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook