Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OLR1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004973-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human OLR1 protein.
  • Immunogen:
  • OLR1 (NP_002534.1, 1 a.a. ~ 273 a.a) full-length human protein.
  • Sequence:
  • MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of OLR1 expression in transfected 293T cell line (H00004973-T02) by OLR1 MaxPab polyclonal antibody.

    Lane 1: OLR1 transfected lysate(31.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4973
  • Gene Name:
  • OLR1
  • Gene Alias:
  • CLEC8A,LOX1,SCARE1
  • Gene Description:
  • oxidized low density lipoprotein (lectin-like) receptor 1
  • Gene Summary:
  • This gene encodes a receptor protein which belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternative transcript variants have been described but their full-length sequence has not been determined. [provided by RefSeq
  • Other Designations:
  • lectin-type oxidized LDL receptor 1,oxidised low density lipoprotein (lectin-like) receptor 1,scavenger receptor class E, member 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook