ODF2 monoclonal antibody (M01), clone 1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ODF2.
Immunogen
ODF2 (NP_002531.3, 706 a.a. ~ 804 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ODF2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ODF2
Entrez GeneID
4957GeneBank Accession#
NM_002540Protein Accession#
NP_002531.3Gene Name
ODF2
Gene Alias
FLJ44866, MGC111096, MGC9034, ODF2/1, ODF2/2, ODF84
Gene Description
outer dense fiber of sperm tails 2
Omim ID
602015Gene Ontology
HyperlinkGene Summary
The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Multiple protein isoforms are encoded by transcript variants of this gene; however, not all isoforms and variants have been fully described. [provided by RefSeq
Other Designations
OTTHUMP00000022273|OTTHUMP00000022274|cenexin 1|outer dense fiber of sperm tails, 84-kD|outer dense fibre of sperm tails 2|sperm tail structural protein
-
Interactome
-
Disease
-
Publication Reference
-
Dual-color live imaging unveils stepwise organization of multiple basal body arrays by cytoskeletons.
Gen Shiratsuchi, Satoshi Konishi, Tomoki Yano, Yuichi Yanagihashi, Shogo Nakayama, Tatsuya Katsuno, Hiroka Kashihara, Hiroo Tanaka, Kazuto Tsukita, Koya Suzuki, Elisa Herawati, Hitomi Watanabe, Toyohiro Hirai, Takeshi Yagi, Gen Kondoh, Shimpei Gotoh, Atsushi Tamura, Sachiko Tsukita.
EMBO reports 2024 Mar; 25(3):1176.
Application:IF, Mouse, Mouse trachea.
-
FBF1 deficiency promotes beiging and healthy expansion of white adipose tissue.
Yingyi Zhang, Jielu Hao, Mariana G Tarrago, Gina M Warner, Nino Giorgadze, Qing Wei, Yan Huang, Kai He, Chuan Chen, Thais R Peclat, Thomas A White, Kun Ling, Tamar Tchkonia, James L Kirkland, Eduardo N Chini, Jinghua Hu.
Cell Reports 2021 Aug; 36(5):109481.
Application:IF, Mouse, Mouse Embryonic Fibroblasts.
-
FAM46C/TENT5C functions as a tumor suppressor through inhibition of Plk4 activity.
Karineh Kazazian, Yosr Haffani, Deanna Ng, Chae Min Michelle Lee, Wendy Johnston, Minji Kim, Roland Xu, Karina Pacholzyk, Francis Si-Wah Zih, Julie Tan, Alannah Smrke, Aaron Pollett, Hannah Sun-Tsi Wu, Carol Jane Swallow.
Communications Biology 2020 Aug; 3(1):448.
Application:IF, Human, U-2 OS cells.
-
TALPID3 and ANKRD26 selectively orchestrate FBF1 localization and cilia gating.
Hao Yan, Chuan Chen, Huicheng Chen, Hui Hong, Yan Huang, Kun Ling, Jinghua Hu, Qing Wei.
Nature Communications 2020 May; 11(1):2196.
Application:IF, Human, Cilia.
-
Posterior Neocortex-Specific Regulation of Neuronal Migration by CEP85L Identifies Maternal Centriole-Dependent Activation of CDK5.
Kodani A, Kenny C, Lai A, Gonzalez DM, Stronge E, Sejourne GM, Isacco L, Partlow JN, O'Donnell A, McWalter K, Byrne AB, Barkovich AJ, Yang E, Hill RS, Gawlinski P, Wiszniewski W, Cohen JS, Fatemi SA, Baranano KW, Sahin M, Vossler DG, Yuskaitis CJ, Walsh CA.
Neuron 2020 Apr; 106(2):246.
Application:IF, Human, U-2 OS cells.
-
ESCRT subunit CHMP4B localizes to primary cilia and is required for the structural integrity of the ciliary membrane.
Eunji Jung, Tae-Ik Choi, Ji-Eun Lee, Cheol-Hee Kim, Joon Kim.
FASEB Journal 2020 Jan; 34(1):1331.
Application:IF, Human, RPE1 cells.
-
Quantitative analysis of sensitivity to a Wnt3a gradient in determination of the pole-to-pole axis of mitotic cells by using a microfluidic device.
Hiraiwa T, Nakai Y, Yamada TG, Tanimoto R, Kimura H, Matsumoto Y, Miki N, Hiroi N, Funahashi A.
FEBS Open Bio 2018 Nov; 8(12):1920.
Application:IF, Human, SH-SY5Y cells.
-
Phosphatidylinositol phosphate kinase PIPKIγ and phosphatase INPP5E coordinate initiation of ciliogenesis.
Xu Q, Zhang Y, Wei Q, Huang Y, Hu J, Ling K.
Nature Communications 2016 Feb; 7:10777.
Application:IF, Human, RPE-1, RCTE cells.
-
Mutations in KIAA0586 Cause Lethal Ciliopathies Ranging from a Hydrolethalus Phenotype to Short-Rib Polydactyly Syndrome.
Caroline Alby, Kevin Piquand, Céline Huber, André Megarbané, Amale Ichkou, Marine Legendre, Fanny Pelluard, Ferechté Encha-Ravazi, Georges Abi-Tayeh, Bettina Bessières, Salima El Chehadeh-Djebbar, Nicole Laurent, Laurence Faivre, László Sztriha0, Melinda Zombor0, Hajnalka Szabó0, Marion Failler, Meriem Garfa-Traore, Christine Bole, Patrick Nitschké, Mathilde Nizon, Nadia Elkhartoufi, Françoise Clerget-Darpoux, Arnold Munnich, Stanislas Lyonnet, Michel Vekemans, Sophie Saunier, Valérie Cormier-Da
American Journal of Human Genetics 2015 Aug; 97(2):311.
Application:IF, Human, Human cilia cells.
-
Type Iγ phosphatidylinositol phosphate kinase targets to the centrosome and restrains centriole duplication.
Xu Q, Zhang Y, Xiong X, Huang Y, Salisbury JL, Hu J, Ling K.
Journal of Cell Science 2014 Mar; 127(Pt 6):1293.
Application:IF, Human, HeLa cells.
-
Dual-color live imaging unveils stepwise organization of multiple basal body arrays by cytoskeletons.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com