OCLN monoclonal antibody (M01), clone 1G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OCLN.
Immunogen
OCLN (NP_002529, 423 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OCLN monoclonal antibody (M01), clone 1G7 Western Blot analysis of OCLN expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of OCLN transfected lysate using anti-OCLN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OCLN MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OCLN is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to OCLN on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — OCLN
Entrez GeneID
4950GeneBank Accession#
NM_002538Protein Accession#
NP_002529Gene Name
OCLN
Gene Alias
-
Gene Description
occludin
Omim ID
602876Gene Ontology
HyperlinkGene Summary
This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. [provided by RefSeq
Other Designations
tight junction protein occludin TM4 minus
-
Pathway
-
Publication Reference
-
Cutibacterium acnes regulates the epidermal barrier properties of HPV-KER human immortalized keratinocyte cultures.
Beáta Szilvia Bolla, Lilla Erdei, Edit Urbán, Katalin Burián, Lajos Kemény, Kornélia Szabó.
Scientific Reports 2020 Jul; 10(1):12815.
Application:IHC-P, WB-Ce, Human, Human keratinocytes, Human skin biopsy samples.
-
Development of a Perfusion Platform for Dynamic Cultivation of in vitro Skin Models.
Strüver K, Friess W, Hedtrich S.
Skin Pharmacology and Physiology 2017 Jun; 30(4):180.
Application:WB-Ce, Human, Human fibroblasts, keratinocytes.
-
Mouse homologues of hepatitis C virus human entry factors inhibit the entry of HCV pseudoparticles (HCVpp) into human hepatoma cells.
Islam MJ, Amin MB, Uddin MKM, Hikosaka K, Noritake H, Wu Y, Aoto K, Miura N.
Bioresearch Communications 2016 Jan; 2(1):128.
Application:WB-Tr, Mouse, NIH/3T3 cells.
-
Cutibacterium acnes regulates the epidermal barrier properties of HPV-KER human immortalized keratinocyte cultures.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com