Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OAS1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004938-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human OAS1 protein.
  • Immunogen:
  • OAS1 (NP_058132.2, 1 a.a. ~ 400 a.a) full-length human protein.
  • Sequence:
  • MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • OAS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of OAS1 expression in MCF-7.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of OAS1 expression in transfected 293T cell line (H00004938-T02) by OAS1 MaxPab polyclonal antibody.

    Lane 1: OAS1 transfected lysate(46.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4938
  • Gene Name:
  • OAS1
  • Gene Alias:
  • IFI-4,OIAS,OIASI
  • Gene Description:
  • 2',5'-oligoadenylate synthetase 1, 40/46kDa
  • Gene Summary:
  • This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • (2'-5') oligoadenylate synthetase 1,2',5'-oligo A synthetase 1,2',5'-oligoadenylate synthetase 1,2',5'-oligoadenylate synthetase 1 (40-46 kD),2'-5' oligoadenylate synthetase 1 p48 isoform,2'-5' oligoadenylate synthetase 1 p52 isoform,2'-5'-oligoisoadenyla
  • RSS
  • YouTube
  • Linkedin
  • Facebook