OAS1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
OAS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of OAS1 expression in MCF-7.
Western Blot (Transfected lysate)
Western Blot analysis of OAS1 expression in transfected 293T cell line (H00004938-T02) by OAS1 MaxPab polyclonal antibody.
Lane 1: OAS1 transfected lysate(46.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human OAS1 protein.
Immunogen
OAS1 (NP_058132.2, 1 a.a. ~ 400 a.a) full-length human protein.
Sequence
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OAS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of OAS1 expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of OAS1 expression in transfected 293T cell line (H00004938-T02) by OAS1 MaxPab polyclonal antibody.
Lane 1: OAS1 transfected lysate(46.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — OAS1
Entrez GeneID
4938GeneBank Accession#
NM_016816.2Protein Accession#
NP_058132.2Gene Name
OAS1
Gene Alias
IFI-4, OIAS, OIASI
Gene Description
2',5'-oligoadenylate synthetase 1, 40/46kDa
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
(2'-5') oligoadenylate synthetase 1|2',5'-oligo A synthetase 1|2',5'-oligoadenylate synthetase 1|2',5'-oligoadenylate synthetase 1 (40-46 kD)|2'-5' oligoadenylate synthetase 1 p48 isoform|2'-5' oligoadenylate synthetase 1 p52 isoform|2'-5'-oligoisoadenyla
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com