Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPR143 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00004935-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GPR143 protein.
  • Immunogen:
  • GPR143 (NP_000264, 1 a.a. ~ 424 a.a) full-length human protein.
  • Sequence:
  • MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Flow Cytometry
  • Flow Cytometry enlargeenlarge this image
  • FACS analysis of negative control 293 cells (Black) and GPR143 expressing 293 cells (Green) using GPR143 purified MaxPab mouse polyclonal antibody.
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GPR143 expression in transfected 293T cell line (H00004935-T01) by GPR143 MaxPab polyclonal antibody.

    Lane 1: GPR143 transfected lysate(46.64 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4935
  • Gene Name:
  • GPR143
  • Gene Alias:
  • OA1
  • Gene Description:
  • G protein-coupled receptor 143
  • Gene Summary:
  • Ocular albinism type 1 protein is a conserved integral membrane protein with seven transmembrane domains. It is expressed in the eye and epidermal melanocytes. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022884,ocular albinism 1 (Nettleship-Falls),ocular albinism-1, Nettleship-Falls type
  • RSS
  • YouTube
  • Linkedin
  • Facebook