Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NVL polyclonal antibody (A01)

  • Catalog # : H00004931-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NVL.
  • Immunogen:
  • NVL (NP_002524, 757 a.a. ~ 856 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ILKTITKNGTKPPLDADVNLEAIAGDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSISKKDQIMYERLQESLSR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004931-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4931
  • Gene Name:
  • NVL
  • Gene Alias:
  • -
  • Gene Description:
  • nuclear VCP-like
  • Other Designations:
  • Nuclear valosin-containing protein-like,OTTHUMP00000035641,nuclear VCP-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook