Product Browser

Last updated: 2017/8/13
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NTF5 polyclonal antibody (A01)

  • Catalog # : H00004909-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NTF5.
  • Immunogen:
  • NTF5 (NP_006170, 111 a.a. ~ 209 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004909-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4909
  • Gene Name:
  • NTF4
  • Gene Alias:
  • NT-4/5,NT4,NT5,NTF5
  • Gene Description:
  • neurotrophin 4
  • Gene Summary:
  • This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood. [provided by RefSeq
  • Other Designations:
  • neurotrophic factor 4,neurotrophic factor 5,neurotrophin 5,neurotrophin 5 (neurotrophin 4/5)
  • RSS
  • YouTube
  • Linkedin
  • Facebook