NT5E monoclonal antibody (M01), clone 4C4-2B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NT5E.
Immunogen
NT5E (AAH15940.1, 28 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (91)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.81 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NT5E expression in transfected 293T cell line by NT5E monoclonal antibody (M01), clone 4C4-2B5.
Lane 1: NT5E transfected lysate(30.36 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — NT5E
Entrez GeneID
4907GeneBank Accession#
BC015940Protein Accession#
AAH15940.1Gene Name
NT5E
Gene Alias
CD73, E5NT, NT, NT5, NTE, eN, eNT
Gene Description
5'-nucleotidase, ecto (CD73)
Omim ID
129190Gene Ontology
HyperlinkGene Summary
Ecto-5-prime-nucleotidase (5-prime-ribonucleotide phosphohydrolase; EC 3.1.3.5) catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP. The enzyme consists of a dimer of 2 identical 70-kD subunits bound by a glycosyl phosphatidyl inositol linkage to the external face of the plasma membrane. The enzyme is used as a marker of lymphocyte differentiation. Consequently, a deficiency of NT5 occurs in a variety of immunodeficiency diseases (e.g., see MIM 102700, MIM 300300). Other forms of 5-prime nucleotidase exist in the cytoplasm and lysosomes and can be distinguished from ecto-NT5 by their substrate affinities, requirement for divalent magnesium ion, activation by ATP, and inhibition by inorganic phosphate.[supplied by OMIM
Other Designations
5' nucleotidase (CD73)|5' nucleotidase, ecto|OTTHUMP00000016808|OTTHUMP00000040565|Purine 5-Prime-Nucleotidase|ecto-5'-nucleotidase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Purine metabolism gene deregulation in Parkinson's disease.
Garcia-Esparcia P, Hernandez-Ortega K, Ansoleaga B, Carmona M, Ferrer I.
Neuropathology and Applied Neurobiology 2015 Dec; 41(7):926.
Application:IHC-P, Human, Brains.
-
Targeted identification of sialoglycoproteins in hypoxic endothelial cells and validation in zebrafish reveal roles for proteins in angiogenesis.
Delcourt N, Quevedo C, Nonne C, Fons P, O'Brien D, Loyaux D, Diez M, Autelitano F, Guillemot JC, Ferrara P, Muriana A, Callol C, Herault JP, Herbert JM, Favre G, Bono F.
The Journal of Biological Chemistry 2015 Feb; 290(6):3405.
Application:WB, Human, HUVECs.
-
Ecto-5'-nucleotidase and intestinal ion secretion by enteropathogenic Escherichia coli.
Crane JK, Shulgina I, Naeher TM.
Purinergic Signalling 2007 May; 3(3):233.
Application:WB, Human, T84 cells.
-
Purine metabolism gene deregulation in Parkinson's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com