Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YBX1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00004904-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human YBX1 protein.
  • Immunogen:
  • YBX1 (NP_004550.2, 1 a.a. ~ 324 a.a) full-length human protein.
  • Sequence:
  • MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of YBX1 expression in transfected 293T cell line (H00004904-T01) by YBX1 MaxPab polyclonal antibody.

    Lane 1: YBX1 transfected lysate(35.90 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4904
  • Gene Name:
  • YBX1
  • Gene Alias:
  • BP-8,CSDA2,CSDB,DBPB,MDR-NF1,MGC104858,MGC110976,MGC117250,NSEP-1,NSEP1,YB-1,YB1
  • Gene Description:
  • Y box binding protein 1
  • Other Designations:
  • DNA-binding protein B,OTTHUMP00000008731,major histocompatibility complex, class II, Y box-binding protein I,nuclease sensitive element binding protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook