NRGN (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NRGN full-length ORF ( AAH02835, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.32
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NRGN
Entrez GeneID
4900GeneBank Accession#
BC002835Protein Accession#
AAH02835Gene Name
NRGN
Gene Alias
RC3, hng
Gene Description
neurogranin (protein kinase C substrate, RC3)
Omim ID
602350Gene Ontology
HyperlinkGene Summary
Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq
Other Designations
calmodulin-binding protein|neurogranin|protein kinase C substrate
-
Interactome
-
Disease
-
Publication Reference
-
Regulation of CaMKII by Phospho-Thr253 or Phospho-Thr286 Sensitive Targeting Alters Cellular Function.
Skelding KA, Suzuki T, Gordon S, Xue J, Verrills NM, Dickson PW, Rostas JA.
Cellular Signalling 2010 May; 22(5):759.
Application:PI, WB-Re, Recombinant protein.
-
Regulation of CaMKII by Phospho-Thr253 or Phospho-Thr286 Sensitive Targeting Alters Cellular Function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com