NRF1 monoclonal antibody (M01), clone 2F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in human Skeletal muscle.
Western Blot (Cell lysate)
NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of NRF1 expression in transfected 293T cell line by NRF1 monoclonal antibody (M01), clone 2F9.
Lane 1: NRF1 transfected lysate (Predicted MW: 55.7 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NRF1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NRF1 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of NRF1 over-expressed 293 cell line, cotransfected with NRF1 Validated Chimera RNAi ( Cat # H00004899-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NRF1 monoclonal antibody (M01), clone 2F9 (Cat # H00004899-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (35.09 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NRF1.
Immunogen
NRF1 (NP_005002, 201 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.09 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in human Skeletal muscle.Western Blot (Cell lysate)
NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of NRF1 expression in transfected 293T cell line by NRF1 monoclonal antibody (M01), clone 2F9.
Lane 1: NRF1 transfected lysate (Predicted MW: 55.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NRF1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NRF1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NRF1 over-expressed 293 cell line, cotransfected with NRF1 Validated Chimera RNAi ( Cat # H00004899-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NRF1 monoclonal antibody (M01), clone 2F9 (Cat # H00004899-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NRF1
Entrez GeneID
4899GeneBank Accession#
NM_005011Protein Accession#
NP_005002Gene Name
NRF1
Gene Alias
ALPHA-PAL
Gene Description
nuclear respiratory factor 1
Omim ID
600879Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1. [provided by RefSeq
Other Designations
OTTHUMP00000184912|alpha palindromic-binding protein
-
Interactome
-
Disease
-
Publication Reference
-
Aconitase 2 inhibits the proliferation of MCF-7 cells promoting mitochondrial oxidative metabolism and ROS/FoxO1-mediated autophagic response.
Ciccarone F, Di Leo L, Lazzarino G, Maulucci G, Di Giacinto F, Tavazzi B, Ciriolo MR.
British Journal of Cancer 2020 Jan; 122(2):182.
Application：WB-Tr, Human, MCF-7 cells.
-
Tributyltin induces epigenetic changes and decreases the expression of nuclear respiratory factor-1.
Hanaoka S, Ishida K, Tanaka S, Sakamoto S, Okuda K, Sanoh S, Ohta S, Kotake Y.
Metallomics : Integrated Biometal Science 2018 Feb; 10(2):337.
Application：WB-Ce, Human, SH-SY5Y cells.
-
Decreased expression of BRCA1 in SK-BR-3 cells is the result of aberrant activation of the GABP Beta promoter by an NRF-1-containing complex.
Thompson C, Macdonald G, Mueller CR.
Molecular Cancer 2011 May; 10:62.
Application：WB-Tr, Human, MCF-7 cells.
-
Aconitase 2 inhibits the proliferation of MCF-7 cells promoting mitochondrial oxidative metabolism and ROS/FoxO1-mediated autophagic response.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com